PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462960005
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family NF-YA
Protein Properties Length: 246aa    MW: 26971 Da    PI: 10.0444
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462960005genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.49.8e-3398153258
  CBFB_NFYA   2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                ep++VNaKQy++Il+RR+ Rakle+++kl  k rkpylheSRh+hA++R+RgsgGrF
  462960005  98 EPIFVNAKQYHAILRRREIRAKLEAQNKL-VKDRKPYLHESRHQHAMKRARGSGGRF 153
                8****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.4E-3795156IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.93396156IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.7E-2898153IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.1E-2499121IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860101121IPR018362CCAAT-binding factor, conserved site
PRINTSPR006163.1E-24130153IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MSESSLNEHT TAQSDSNDHH GKHDKNRMKS VLSLGKQEAA FLPQNLEYNS SFASVPYAAD  60
TYYGEVFTGY SPPAIVHPPQ NGISSSPVPL PVEPAAVEPI FVNAKQYHAI LRRREIRAKL  120
EAQNKLVKDR KPYLHESRHQ HAMKRARGSG GRFLNTKQLQ EQNQQHQASC GSSSTQATGQ  180
NVCSQNGSTH TPPTPAPPSV TSLSRANQDR SCFPSVGFRP TVNFSAQGGR DTKLVANGMQ  240
HVVSMR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-2298172374NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0967381e-81FP096738.1 Phyllostachys edulis cDNA clone: bphylf045e19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958253.11e-102PREDICTED: nuclear transcription factor Y subunit A-4-like isoform X2
RefseqXP_012698907.11e-102PREDICTED: nuclear transcription factor Y subunit A-4-like isoform X2
RefseqXP_012698906.11e-102PREDICTED: nuclear transcription factor Y subunit A-4-like isoform X2
RefseqXP_004958254.11e-102PREDICTED: nuclear transcription factor Y subunit A-4-like isoform X2
TrEMBLA0A0A9DJ421e-108A0A0A9DJ42_ARUDO; Uncharacterized protein
STRINGSi030663m1e-101(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.17e-34nuclear factor Y, subunit A5